<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown 52
2 D4T+DDI+EFV+IDV+RTV 96
3 ABC+IDV+RTV+TDF 116

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, L210W, T215Y V75L K101E, Y181C, G190A A98G T39K, K43E, V60VI, V118I, I135T, E203D, Q207D, H208HY, R211K, H221HY, L228LH, V245EKQ, A288S  
>CA63818| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSAKWRKLLDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIDELRDYLWKWGFYTPDKKYQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82A, L90M L33I, L89V L10I, I13V, L19LV, K20I, E35D, M36I, N37ND, L63P, C67L, H69K, A71IV, I72IM  
>CA63817| codons 1-99
PQITLWQRPIVTVKIGGQVIEALLDTGADDTVIEDIDLPGRWKPKIIGGIGGFAKVRQYD
QIPIEILGKKIMGTVLVGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012