<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+IDV+NFV 13
3 3TC+ABC+AZT+D4T+DDI+EFV 22
4 3TC+ABC+D4T+EFV 43
5 3TC+D4T+LPV+TDF 129

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M V11I, Q58E, G73S L10I, K14R, I15V, L19LP, K20I, E35N, M36I, R57K, I62V, L63P, A71V, I72IL  
>CA63815| codons 1-99
PQITLWQRPIITIRVGGQPIEALLDTGADDTVLENINLPGRWKPKMIGGIGGFVKVKEYD
QVPIEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184IV, L210W, T215Y   K103KN   S3C, E6K, T39TA, E44ED, K64R, V90I, K122E, I135T, V179I, T200TAIV, E203EQ, Q207D, R211K, R284K, T286A, A288T K43KHNQ
>CA63816| codons 1-311
PICPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEHDGKISKIGPENPYNTPV
FAIRKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYIDDLYVGSDLEIGQHRAKIQELRDHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKTLTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006