<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 80
2 D4T+NVP+RTV 65
3 ABC+APV+D4T+RTV 274
4 ABC+D4T+APV+RTV 53

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219H K103N, Y181YC   E6D, T7P, E44D, V60I, W88WS, A98S, V118VI, K122P, I135V, S162SN, D177E, H208HY, R211K, L228LH, A272P, E297A  
>CA63814| codons 1-311
PISPIDPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFSEVQLGIPHPSGLKKNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDHKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54M, V82A, L90M L33F, K43T L10I, D60E, L63P, I64M, A71V, L89M, I93L  
>CA63813| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIFEEMNLPGRWTPKIIGGIGGFMKVRQYE
QIPMEICGHKVIGTVLVGPTPANIIGRNMMTQLGCTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012