<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT+DDC 109
2 D4T+DDI+RTV 19
3 D4T+DDC+NFV+RTV 31
4 D4T+NFV+RTV 10
5 D4T+IDV+NFV+RTV 20
6 D4T+NFV 14
7 3TC+D4T+EFV+NFV 32
8 ABC+APV+D4T 63
9 D4T+IDV+NVP+RTV 27
10 AZT+DDI+LPV 130
11 ATV+DDI+NVP 22
12 3TC+ATV+DDI+RTV+TDF 69
13 DDI+DLV+APV+FTC+RTV+TDF 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y K219KN K101E, Y181C, G190A V108VI T39A, E44D, V118I, D123E, I135T, I178IM, T200A, Q207E, R211K, L228N, P294Q  
>CA63812| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYVDDLYVASDLEIGQHRAKIEELREHLWKWGFYTPDNKHQKEPPFNWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76V, V82A L10F, L23I, L33F, Q58E I13V, R57K, D60E, L63P, A71V, I93L  
>CA63811| codons 1-99
PQITLWQRPFVTVKIGGQLKEAILDTGADDTVFEEMNLPGRWKPKMIGGIGGFVKVKEYE
QIPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009