<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV 148
2 3TC+D4T+RTV 9
3 APV+DDI+NVP+RTV 267

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, V82A, I84V, L90M L10F, K43T K20R, M36I, Q61E, I62V, L63P, A71V, I72K, Q92QK  
>CA63809| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADDTVLEEINLPGRWTPKMIGGIGGFLKVRQYD
EVPIEICGHKVKGTVLVGPTPANVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74V, T215F D67G, K219Q K103N, Y181C   K20R, K43N, T69N, I142V, G196E, I202V, H221HY, V245EK, A288S  
>CA63810| codons 1-311
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKGSNRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTPDQKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010