<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 63
2 AZT+DDI 10
3 3TC+AZT+IDV 166
4 ABC+D4T+EFV 313
5 APV+FTC+MVC+RTV+T20+TDF 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y   Y188L V108VI V35I, T39A, K43E, E44D, V106I, T107S, V118I, K122E, I135T, I142V, V179I, V189I, T200K, I202V, E203D, Q207E, H208Y, R211K, H221Y, V245K, K275R, T286P, E297K  
>CA63806| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSISILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLIGSDLEIGQHRKKVDELREYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGPKALTEVIPLTKEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A, L90M L33F L10I, E35D, N37D, R41K, I62V, L63P, A71IT, V75VI, I93L  
>CA63805| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEDMDLPGKWKPKLIGGIGGFLKVRQYD
QVPIEICGHKIIGTILVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012