<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDC 122
2 3TC+ABC+AZT+DDC 31
3 D4T+DDI+RTV+SQV 226
4 ATV+D4T+DDI+RTV 39
5 D4T+DDI+NVP 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, R41K, L63P, A71T, I72E, V77I, I93L  
>CA63797| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, T215F K219Q Y181YC, G190A K238KT K20R, V35VM, K43KN, T69N, V90I, K122KE, D177DN, I178M, I180IV, Q207E, H208Y, R211K, D218E, L228H, V245K, A272P, R284RK, A288S I37L, N175ND
>CA63798| codons 1-311
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMELCTELENEGKISKIGPENPYNTPV
FAIKKKNSNRWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQDPNMVV
CQYMDDLYVASDLEIGQHRTKIEELREYLLKWGFFTPEQKHQKEPPFHWMGYELHPDTWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKSLTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006