<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 87
2 DDI 148
3 AZT+DDC+DLV 83
4 RTV+SQV 35
5 D4T+EFV+RTV+SQV 31
6 3TC+ABC+APV+D4T 178
7 3TC+ABC+APV 91
8 IDV+RTV+TDF 39
9 APV+RTV+TDF 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54L, I84V, L90M L10F, V11I, L33F, Q58E, L89V I13V, I15IV, K20T, E35D, M36I, R41K, D60E, I62V, L63P, A71V, V77VI, P79H  
>CA63795| codons 1-99
PQITLWQRPFITVKVGGQLTEALLDTGADDTIFEDINLPGKWKPKMIGGIGGFLKVREYE
QVPIEICGHKVIGTVLIGHTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, V75T, M184MV, L210W, T215Y K219D K103N L234I E6EK, V35VIM, E36EQK, T39TA, E40EK, K43E, K64R, V118I, K122E, G196E, T200A, E203K, Q207E, D218E, F227Y, L228H, A272AP, T286A  
>CA63796| codons 1-311
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALIQICAKLEEEGKISKIGPENPYNTPV
FAIRKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELREHLWRWGFYTPEDKHQKEPPYHWMGYEIHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006