<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT 43
2 3TC+D4T+RTV 196
3 DDI+EFV+LPV 189

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I47V, I54V, V82F L33F, F53FL L10IV, M36L, P39Q, R41K, I62V, L63P, A71V, I93L  
>CA63793| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEELNLQGKWKPKIVGGIGGLVKVRQYD
QVPIEICGHKVIGTVLVGPTPFNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215Y   K103N, Y181C A98G, V108I, F227FL T39A, I142V, R211K, H221Y  
>CA63794| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKYQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010