<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_142 JF_142 CAR 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12K, I13V, L19I, K20I, E35D, M36I, N37E, R41RT, R57K, Q61QR, I64M, C67G, H69K, V82VI, L89M  
>JF_142| codons 2-99
QITLWQRPLIKVKIGGQIIEALLDTGADDTVLEDIELPGTWKPKMIGGIGGFIKVKQYDR
ILMEIGGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, V35T, T39N, E40D, K43R, V60I, D123E, S162F, K173A, Q174A, T200A, Q207G, R211K  
>JF_142| codons 1-248
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICNDMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRAANPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPE

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006