<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_136 JF_136 CAR 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36EA, T39M, V60I, V118I, K122E, T165TI, D177E, I178M, Q207A, F214L, K238R, V245T  
>JF_136| codons 12-255
LKPGMDGPKVKQWPLTEEKIKALTAICMEMEKEGKISKIGPENPYNTPIFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFT
IPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEMVIYQYMDDLYVGS
DLEIGQHRTKIEELRAHLLRWGLTTPDKKHQKEPPFLWMGYELHPDRWTVQPITLPEKDS
WTVN

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006