<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_129 JF_129 CAR 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, V60I, S68G, K122KPQT, D123N, I142V, A158S, K173A, Q174K, D177E, T200A, Q207K, H208HL, R211T, V245E  
>JF_129| codons 12-255
LKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPIFAIKKKDGTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDTNFRKYTAFT
IPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPEIVIYQYMDDLYVGS
DLEIGQHRAKIEELRKLLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDS
WTVN

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006