<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_109 JF_109 CAR 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      E138EK E6D, K11T, K22R, V35T, T39K, K43E, S68G, D121Y, K122E, D123G, N147NK, T165I, K173T, Q174K, D177DE, T200TA, I202IV, Q207A, R211S, K238R, V245Q  
>JF_109| codons 1-255
PISPIDTVPVTLKPGMDGPKVRQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSINNKTPGIRYQYKVLPQGWKGSPAIFQSSMIKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIQLPEKDSWTVN

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006