<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_101 JF_101 CAR 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, I13V, L33V, E35D, M36I, R41K, H69K, L89M  
>JF_101| codons 1-99
PQITLWQRPMVTVKIGGQLKEALLDTGADDTVVEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6ED, K11A, V35T, T39TK, K122E, D123NS, K166R, K173A, Q174R, D177E, T200TM, Q207D, R211K, V245LQ, E248D, D256E  
>JF_101| codons 1-256
PISPIDTVPVALKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRARNPEIVI
YQYMDDLYVGSDLEIGQHRMKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNE

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006