<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_090 JF_090 CAR 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, L19M, K20R, E35D, M36I, R41K, H69Q, L89M  
>JF_090| codons 1-99
PQITLWQRPVVTIKVGGQMREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T69TA, K122E, D123N, K173T, T200A, Q207A  
>JF_090| codons 29-244
EKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSAKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRTQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRAH
LLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006