<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_079 JF_079 CAR 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, R41K, I62V, L63V, G68E, H69K, K70R, L89M, T91V, I93L  
>JF_079| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVVIEICEKRAIGTVLVGPTPVNIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35IT, T39N, E40D, D123E, I142V, A158S, K173A, Q174K, D177E, V179I, Q207D, R211K  
>JF_079| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006