<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_022 JF_022 CAR 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, I13V, L19I, K20I, E35D, M36I, N37D, R57K, Q61E, L63S, I64IM, C67S, H69R, P79PS, V82I, L89M  
>JF_022| codons 1-99
PQITLWQRPLVEVKIGGQIIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVKQYD
EISMEISGRKAIGTVLVGSTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006