<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF_002 JF_002 CAR 2005 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, K20R, E35D, M36I, R41K, D60DE, Q61QE, I62IV, I64IM, H69Q, I72V, V82VI, L89M, I93IL  
>JF_002| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
EVLMEICGQKAVGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, T39A, E40D, V106VI, V118I, K122EQ, D123DE, T139TA, K173T, Q174K, D177E, I178M, T200A, R211T, F214L K220KN, W229WL, P236PH
>JF_002| codons 23-241
QWPLTEEKIKALMEICADMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPLDQEFRKYTAFTIPSINNEAPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRAKI
EELRQHLLTWGLTTPDKNHQKEPPFLLMGYELHHDKWTV

References
Author Title Citation
Marechal, V Increasing HIV type 1 polymorphic diversity but no resistance to antiretroviral drugs in untreated patients from Central African Republic: a 2005 study. ARHR, 2006