<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV_MBTB047 02.MBTB047 DRC 2002 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2H, T4S, G16E, K20R, M36I, P39S, R41K, I62V, L63T, E65D, H69R, L89M  
>02.MBTB047| codons 1-99
PHISLWQRPLVTIKIEGQLREALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYD
QVTIDICGRKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        L34I, V35T, T39K, I50V, V60I, D123E, I142V, K173S, D177E, Q207A, R211K, I244V, V245I, D250E, E291D, V292I, I293V, P294T, E297K, E312D, R356K, M357R, R358K, G359S, A360T, T369A, A371V, I375V, A376T, T377M, K390R, E399D, A400T, K431T, V435X  
>02.MBTB047| codons 1-438
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICKEMEKEGKISKVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVILPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVTLTKEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKRKST
HTNDVKQLAEVVQKVTMESIVIWGKTPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIXGAE

References
Author Title Citation
Vidal, N HIV type 1 pol gene diversity and antiretroviral drug resistance mutations in the Democratic Republic of Congo (DRC). ARHR, 2006