<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV_LBR032 02.LBR032 DRC 2002 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, N37S, R41K, L63Q, I64V, H69Y, V77I  
>02.LBR032| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGYKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, V60I, K122E, D177E, I178M, V179I, Q207E, R211K, V245E, S251N, A272P, K275Q, K277R, T286A, I329V, Q334L, F346Y, R356K, A360T, T377Q, K390R, A400T  
>02.LBR032| codons 1-439
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDNWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGLGQWTYQIYQEPYKNLKTGKYAKMRGT
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAET

References
Author Title Citation
Vidal, N HIV type 1 pol gene diversity and antiretroviral drug resistance mutations in the Democratic Republic of Congo (DRC). ARHR, 2006