<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV_KSFE141 02.KSFE141 DRC 2002 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, I64V  
>02.KSFE141| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35T, K49R, V60I, K122E, A158T, Q207E, R211K, V245E, D250E, A272P, T286A, I293V, Q334H, M357A, T369A, A376V, T386A, K390R, K395R, A400T, V435I, E438D  
>02.KSFE141| codons 1-438
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARARGA
HTNDVKQLAEAVQKIVTESIVIWGKAPKFRLPIQRETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAD

References
Author Title Citation
Vidal, N HIV type 1 pol gene diversity and antiretroviral drug resistance mutations in the Democratic Republic of Congo (DRC). ARHR, 2006