<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV_KIST132 02.KIST132 DRC 2002 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, I62V, L63P, C67Y, K70R  
>02.KIST132| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEIYGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39I, E40D, K49R, K122E, T165I, D177E, T200A, Q207E, P243S, V245Q, D250E, A272P, K311R, Q334H, M357T, A376T, K385R, K390R, A400T, T403I, V435I  
>02.KIST132| codons 1-444
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKITTESIVIWGRTPKFRLPIQKETWETWWIEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDG

References
Author Title Citation
Vidal, N HIV type 1 pol gene diversity and antiretroviral drug resistance mutations in the Democratic Republic of Congo (DRC). ARHR, 2006