<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV_KBS187 02.KBS187 DRC 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, G17E, K20I, E35D, M36I, N37Q, H69K, L89M  
>02.KBS187| codons 1-99
PQITLWQRPLVSVKIGEQLIEALLDTGADDTVLEDIQLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11R, V35T, T39K, K43E, K122E, D123N, I135T, I142V, K173A, Q174K, D177E, T200A, Q207A, R211S, F214L, V245Q, K249Q, T286A, E291D, V292I, I293V, E297R, A304E, E312N, G335D, R356K, M357R, R358K, G359S, A360T, V365I, T377M, K390R, A400T, E404D, V435A  
>02.KBS187| codons 1-438
PISPIDTVPVRLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEQDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTREAE
LELEENREILKNPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRKST
HTNDIKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAE

References
Author Title Citation
Vidal, N HIV type 1 pol gene diversity and antiretroviral drug resistance mutations in the Democratic Republic of Congo (DRC). ARHR, 2006