<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JEG32 JEG32_w12 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+TDF 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V179D T39A, R83RK, V106VI, K122E, I135V, S162C, G196GE, T200A, R211G, E248D, A272P, A288S, E297K  
>JEG32_w12| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTKEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12AS, L19Q, N37C, L63P, V77I  
>JEG32_w12| codons 1-99
PQITLWQRPLVSIKIGGQQKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gallant, JE Early virologic non-response to tenofovir, abacavir, and lamivudine in HIV-infected antiretroviral naive subjects. J Infect Dis, 2005