<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JEG30 JEG30_w12 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+TDF 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184MIV K219R     V35L, S48T, K102Q, K104R, K122E, D123N, S162Y, E169D, K173KR, D177E, V179I, A272PS  
>JEG30_w12| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRRQNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, R41K, R57K, L63P, V77VI  
>JEG30_w12| codons 1-99
PQITLWQRPLVIIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gallant, JE Early virologic non-response to tenofovir, abacavir, and lamivudine in HIV-infected antiretroviral naive subjects. J Infect Dis, 2005