<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMG98 98_w55 U.K. 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV NA
2 3TC+AZT NA
3 3TC+AZT+NFV 10
4 None NA
5 3TC+AZT+NFV 13
6 None NA
7 3TC+AZT+NFV 31
8 3TC+AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37D, R41K, Q61QE, H69K, I72IV, L89M  
>98_w55| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11AT, V35T, K46KQ, S48ST, K49R, I50IV, V60I, D121DY, K122E, D123DGNS, I135T, T165TI, E169D, K173A, Q174K, D177E, G196E, Q207A, V245M, A272P, T286A, E291D, I293V, E312D, G335D, M357R, G359S, T369A, A371V, I375V, S379SG  
>98_w55| codons 1-400
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGQITRVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILDPFRAKNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARRRSA
HTNDVKQLAEVVQKVATEGIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Gibb, DM Evolution of antiretroviral phenotypic and genotypic drug resistance in antiretroviral-naive HIV-1-infected children treated with abacavir/lamivudine, zidovudine/lamivudine or abacavir/zidovudine, with or without nelfinavir (the PENTA 5 trial). Antivir Ther, 2002