<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMG63 63_w27 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC+AZT 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       K122KRT, D123E, I180IV, Q207E, R211K, A272P, K275R, K277R, Q278H, R284RK, A288AS, I293IV, E297K, I329L, Q334E, M357T, A360T, A376T, K390R, E396D K287K*
>63_w27| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DTEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLLKGT*SLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGEGQWTYQIYQEPFKNLKTGKYARTRGT
HTNDVKQLTEAVQKITTESIVIWGKTPKFRLPIQKDTWE

References
Author Title Citation
Gibb, DM Evolution of antiretroviral phenotypic and genotypic drug resistance in antiretroviral-naive HIV-1-infected children treated with abacavir/lamivudine, zidovudine/lamivudine or abacavir/zidovudine, with or without nelfinavir (the PENTA 5 trial). Antivir Ther, 2002