<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMG57 57_w38 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+NFV 38

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35IM, V60VI, K103KR, D123E, I178IM, G196E, R211K, A272P, K281R, A288S, I293IV, E297K, I329L, G333E, M357T, K366KR, T369V, I375IV, A376T, K390R R83EK, F130FC
>57_w38| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKEFRKYTACTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKSLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQEQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVRQLVEAVQKVTTESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10IV, I13IV, N37S, Q61E, L63P, C67Y, H69K, A71T, V77VI  
>57_w38| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
EIPIEIYGKKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gibb, DM Evolution of antiretroviral phenotypic and genotypic drug resistance in antiretroviral-naive HIV-1-infected children treated with abacavir/lamivudine, zidovudine/lamivudine or abacavir/zidovudine, with or without nelfinavir (the PENTA 5 trial). Antivir Ther, 2002