<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMG46 46_w48 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC+AZT+NFV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  I50IN L10I, E35D, L63T, I93L  
>46_w48| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGNGGFIKVRQYD
QITIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21VI, D123E, D177N, G196E, R211S, A272P, K277R, K281KR, T286A, K287R, P294T, E297R, I329V, Q334E, P345PQ, F346FC, A376S, E399D K22K*
>46_w48| codons 1-399
PISPIETVPVKLKPGMDGPKI*QWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGARALTEVITLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEQCKNLKTGKYARMRGA
HTNDVKQLTEAVQKISTESIVIWGKTPKFKLPIQKETWD

References
Author Title Citation
Gibb, DM Evolution of antiretroviral phenotypic and genotypic drug resistance in antiretroviral-naive HIV-1-infected children treated with abacavir/lamivudine, zidovudine/lamivudine or abacavir/zidovudine, with or without nelfinavir (the PENTA 5 trial). Antivir Ther, 2002