<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt-A ptAW40 U.S. 1995 HIV1 B PBMC MMC

Treatment History
Order Regimen Weeks
1 IDV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, I84V L24I L10R, T12I, N37D, L63P, A71V  
>ptAW40| 1 | codons 1-99 | clone 1
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLAGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNL
>ptAW40| 2 | codons 1-99 | clone 2
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF
>ptAW40| 3 | codons 1-99 | clone 3
PQITLWQRPVVIIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF
>ptAW40| 4 | codons 1-99 | clone 4
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF
>ptAW40| 5 | codons 1-99 | clone 5
PQITLWQRPVVIIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVISTVLVGPTPTNIIGRNLLTQIGCTLNF
>ptAW40| 6 | codons 1-99 | clone 6
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQISCTLNF
>ptAW40| 7 | codons 1-99 | clone 7
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF
>ptAW40| 8 | codons 1-99 | clone 8
PQITLWQRPVVIIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPTNVIGRNLLTQIGCTLNF
>ptAW40| codons 1-99
PQITLWQRPRVIIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPTNVIGRNLLTQIGCTLNF

References
Author Title Citation
Condra, JH Genetic correlates of in vivo viral resistance to indinavir, a human immunodeficiency virus type 1 protease inhibitor. J Virol, 1996
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005