<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR04RS178 BR04RS178 Brazil 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, K14N, I15V, L19I, M36I, R57K, Q61N, L63P  
>BR04RS178| codons 5-99
LWQRPLVKINVGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYDNIPI
EICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39I, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211K  
>BR04RS178| codons 20-218
KVKQWPLTEEKIKALTEICIEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNET
PGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVIYQYMDDLYVGSDLEIGQHR
AKIEELREHLLKWGFTTPD

References
Author Title Citation
Rodrigues, R Low prevalence of primary antiretroviral resistance mutations and predominance of HIV-1 clade C at polymerase gene in newly diagnosed individuals from south Brazil. Virus Res, 2006