<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6361 CA59609 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+DDI 30
3 3TC+AZT+IDV 205
4 3TC+ABC+AZT+IDV 43
5 ABC+D4T+RTV+SQV 243

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R     E6DN, K20R, T39E, E44D, V60I, V118VI, K122E, Q207E, D218E, E248D, A272AP, T286A, E297K, I326V T131TI
>CA59609| codons 1-335
PISPINTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFIIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWRWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M V11I, N88T L10I, I15V, Q18H, L19I, K20I, M36I, N37D, K55R, K70R, A71V, I72M, P79D  
>CA59608| codons 1-99
PQITLWQRPIITIKVGGHIIEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIRVRQYD
QILIEICGHRVMGTVLVGDTPVNVIGRTLMTQIGCTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012