<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DC_019 19_3007w24 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 3TC+ABC+TDF 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215E     S68G, K102Q, D123E, I135T, D177E, I178M, T200I, R211K  
>19_3007w24| codons 33-239
ALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKQKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQG
WKGSPAIFQSSMTKILEPFRKQNPEMVIYQYVDDLYVGSDLEIGQHRIKIEELRQHLLKW
GFETPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Delaunay, C Comparative selection of the K65R and M184V/I mutations in human immunodeficiency virus type 1-infected patients enrolled in a trial of first-line triple-nucleoside analog therapy (Tonus IMEA 021). J Virol, 2005