<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DC_018 18_2001w12 France 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 3TC+ABC+TDF 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I     V179D V35T, E40D, K49R, E53D, V60I, V118I, K122Q, D123N, T165V, D177E, I178L, Q207E, F214L  
>18_2001w12| codons 33-239
ALTEICTDMEKEGKISRIGPDNPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSIPLDQNFRKYTAFTIPSINNETPGIRYQYNVLPQG
WKGSPAIFQSSMVKILEPFRKQNPELDIYQYIDDLYVGSDLEIGQHRTKIEELREHLLRW
GLTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Delaunay, C Comparative selection of the K65R and M184V/I mutations in human immunodeficiency virus type 1-infected patients enrolled in a trial of first-line triple-nucleoside analog therapy (Tonus IMEA 021). J Virol, 2005