<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DC_001 01_5005w0 France 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, V60I, S68G, V90I, K122E, D123S, I135T, S162A, K173S, T200A, Q207A, R211S  
>01_5005w0| codons 33-239
ALTEICMEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEIQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQG
WKGSPAIFQASMTKILEPFRSQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSW
GFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Delaunay, C Comparative selection of the K65R and M184V/I mutations in human immunodeficiency virus type 1-infected patients enrolled in a trial of first-line triple-nucleoside analog therapy (Tonus IMEA 021). J Virol, 2005