<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA26324 CA61104 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 3TC+AZT+IDV 109
3 3TC+D4T+NFV 291
4 3TC+NFV+TDF 122

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, M184V       K43KN, E138A, I142T, S162C, K173KE, I178IM, L210LF, R211K, F214L, V245T, V261VG, A272P, V292I  
>CA61104| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMENEGKISKIGPENPYNTPV
FAIKKKDSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNATPGTRYQYNVLPQGWKGSPAIFQCSMTKILEPFREQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLFKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLGGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33F, N88D E35D, N37P, R57K, I62V, L63P, H69Q, A71T, V77VI  
>CA61103| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVFEDMPLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGQKTIGTVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012