<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17662 CA60911 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 161
2 D4T+NVP+TDF 48
3 D4T+EFV+TDF 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, K20I, M36MI, I62V, L63AP, I64IV, A71AV, T74S, I93L  
>CA60911| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKVIGSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215F   K103N, V106VA   K20KR, V35T, V118I, K122IV, V179VI, T200A, Q207E, R211K, F214L, V245T, E248D, A272P, T286A  
>CA60912| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSIPL
DVDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009