<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7998 CA60854 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 8
2 3TC+ABC+AZT 253

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E   E138K, V179D K20R, V35VI, V60I, K64HN, K122P, I135V, I142V, R211A, V245K, A272P, K277R, L283I, I293V, G335S, Y339W, R356K  
>CA60854| codons 1-368
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAINKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNKTPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLAWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQSQWTWQIYQEPFKNLKTGKYAKMRGA
HTNDVKQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, N37S, I62V, L63H, V77VI  
>CA60853| codons 1-99
PQITLWQRPLVEIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVHIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009