<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1144 CA60841 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 57
3 AZT+DDI 8
4 AZT+DDC 35
5 3TC+D4T 13
6 AZT+D4T+RTV+SQV 57
7 AZT+D4T+RTV+SQV 31
8 3TC+D4T+NFV 17
9 3TC+D4T+NFV+NVP 52
10 3TC+D4T+NFV+NVP 26
11 3TC+D4T+IDV+RTV 233
12 3TC+IDV+RTV+TDF 24
13 3TC+D4T+IDV+RTV 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54A, V82AT, L90M Q58E L10V, T12TK, L19I, F53Y, D60DE, Q61E, I62V, L63P, A71V, I72V, T74S, V77I, I93L  
>CA60841| codons 1-99
PQITLWQRPVVKIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGYAKVREYE
EVPIEICGHKVVGSVLIGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69D, K70R, M184V, T215F K219Q     K20KR, A33AG, V35M, V118I, K122E, I135T, S162AD, V179I, I202V, F214L, K223KQ, L228H, E248EK, A272P, K277R, A288AT I159IL
>CA60842| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKGLMEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPALFQDSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQQEPPFHWMGYELHPDKWT
VQPIVLPKKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010