<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5121 CA60793 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 144
2 3TC+AZT+DDC+SQV 13
3 AZT+DDC+IDV 43
4 3TC+D4T 161
5 ABC+APV+NVP+RTV 122
6 ABC+APV+TDF 87
7 3TC+ATV+RTV+TDF 81

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L10F, F53L I13V, K20R, E35D, M36I, R41K, I64V  
>CA60793| codons 1-99
PQITLWQRPFVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGLIKVRQYD
QILVEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       V60I, V118I, K122E, I135T, T200E, V245K, A272P, K275Q, V276T, K277R, A288S, I293V, D324E  
>CA60794| codons 1-368
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIQTRQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009