<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_09 GBS_09 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC NA
2 AZT+DDC+SQV NA
3 3TC+D4T+IDV NA
4 D4T+DDI+EFV NA
5 D4T+DDI+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T, L90M   L63P, H69N, A71V, V77I  
>GBS_09| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGNKVIGTVLIGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N L100I, K103N   E44D, V60I, K104R, K122E, D123E  
>GBS_09| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNRSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005