<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_08 GBS_08 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+DDC+DDI+EFV+NFV+NVP+RTV+SQV NA
2 3TC+D4T+DDI+LPV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84IV, L90M L33F, F53L, G73S L10I, G16A, L24LF, N37D, K55R, I62V, L63P, A71I, I72IM, V77I, I93L  
>GBS_08| codons 4-99
TLWQRPIVTIKIAGQLKEALFDTGADDTVFEEMDLPGRWKPKIIGGIGGLVRVRQYDQVP
IEICGHKIMSTVLIGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y K219R K103NS, G190A   K43E, T69N, V106VI, V118I, I135L, S162SN, I178M, E203K, Q207E, H208Y, R211K, L228H, Q242H K223AE
>GBS_08| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSNKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSITVLDVGDAYFSIPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDMVIYQYVDDLYVASDLEIGQHRTKIKELREYLWKWGFYTP
DRKHQEEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005