<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_07 GBS_07 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI NA
2 DDI+RTV NA
3 3TC+D4T+IDV NA
4 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   K103S, G190A   K101R, D121Y, K122E, I135T, F214L L120I
>GBS_07| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLRKSKSVTVLDVGDAYFSVPIYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLFTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI L33LF T12N, E34EQ, N37NS, R41K, L63P, I64V  
>GBS_07| codons 4-99
TLWQRPLVNIKIGGQLKEALLDTGADDTIFQEMSLPGKWKPKMIGGIGGFIKVRQYDQIP
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005