<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_54 GBS_54 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA
2 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, Y188L   K122E, I135R, K173Q, I178M, E194D, T200E, E204A  
>GBS_54| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPDMVIYQYVDDLLVGSDLDIGQHREKIEALRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, N37NS, R41K, I72IV  
>GBS_54| codons 4-99
TLWQRPLVTIKIEGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005