<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_53 GBS_53 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T NA
3 AZT+DDI NA
4 AZT+DDC+RTV NA
5 3TC+D4T+IDV NA
6 D4T+DDI+NFV+NVP NA
7 APV+D4T+DDI+RTV+T20 NA
8 D4T+DDI+LPV+SQV+TDF NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M V32VL L10I, T12Q, I15V, L19Q, K20M, M36I, D60E, L63P, A71I, I93L  
>GBS_53| codons 4-99
TLWQRPIVQIKVGGQQMEALLDTGADDTLLEEINLPGRWKPKMIGGIGGFVKVRQYEQIP
IEICGHKIIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   K101E, Y181C, G190A   K43E, E44D, K64R, R83K, V118I, K122E, I135T, I142F, T200IV, R211K, L228H  
>GBS_53| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIRKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGFRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRVKIEELRQHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005