<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_52 GBS_52 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT NA
2 3TC+AZT+IDV NA
3 3TC+AZT+NFV NA
4 D4T+DDI+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219E K103N, Y181C K238T A98S, I135T, F214L, L228R  
>GBS_52| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
DEKHQKEPPFRWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, I15V, K20T, E35D, M36L, N37E, R57K, I62V, L63P, A71V  
>GBS_52| codons 4-99
TLWQRPLVTVKVGGQLTEALLDTGADNTVLEDLELPGRWKPKMIGGIGGFIKVKQYDQVP
IEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005