<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_04 GBS_04 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 AZT 67
3 AZT+DDC 67
4 AZT+DDI 67
5 3TC+AZT 67
6 3TC+D4T 67
7 3TC+D4T+RTV 67
8 3TC+AZT+NFV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L L23I I13V, I15V, K20T, M36I, L63P, H69K, A71T, L89I, Q92R  
>GBS_04| codons 4-99
TLWQRPLVTVKVGGQLTEAILDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYDQIP
IEICGKKTIGTVLVGPTPVNIIGRNILTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y   G190A   V90VI, D123E, I135T, D177E, I178IL, V179VI, R211K  
>GBS_04| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELIIYQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005