<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_45 GBS_45 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+DDI+RTV+SQV NA
2 3TC+D4T+EFV+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L10FI, L23I, L33F, Q58E I13IV, E34EQ, I62V, L63P, A71V, I72V  
>GBS_45| codons 4-99
TLWQRPIVTVKIGGQLKEAILDTGADDTVFQEMNLPGRWKPKLIGGIGGFVKVREYDQVP
IEICGHKVVGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   G190E V108VI K43N, E44D, I94IL, K102KR, K103R, T107S, L109I, D123E, K166R, D177E, T200A, H208Y, R211K, K223Q N137I
>GBS_45| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGLPHP
AGLKRRKSVSIIDVGDAYFSVPLDKEFRKYTAFTIPSINIETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVESDLEIGQHRAKIEELRQYLWKWGFYTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005