<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_44 GBS_44 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC NA
3 AZT+RTV NA
4 3TC+AZT+RTV+SQV NA
5 AZT+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   K20R, E35D, M36I, R41K, R57K, Q61K, I62V, L63P, A71T  
>GBS_44| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVKQYDKVP
IEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       T69TS, K82R, R83K, K122KE, S134G, I178L, H208Y, R211K  
>GBS_44| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSSKWRKLVDFRELNRKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPGINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELRQYLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005