<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_43 GBS_43 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 D4T+DDI NA
4 D4T+DDI+SQV NA
5 D4T+DDI+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, I13V, K20KR, M36I, I62V, L63P, I64V, T74S, I93L  
>GBS_43| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIVGIGGFVKVRQYDQVP
VEICGHKAIGSVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, V75VAIT K219Q     K49R, E53D, K64Y, K122E, Q174H, G196E, Q207E, R211K L187W, K201E
>GBS_43| codons 38-247
CTEMEKEGKISRIGPDNPYNTPVFAIYKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKHNPDIVIYQYMDDWYVGSDLEIEQHRTEIEELREHLLKWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005